Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU325680_30.cds

Sequence	EU325680_30.cds
Peptide	MTDLNLPSIFVPLVGLVFPAIAMASLFLYVQKNKIV
Structure From Source	EU325680
Source Exons	1 111
Corresponding Protein	EU325680_30.protseq
Gene	psaI
Gene Product	PSI small peptide
Remark	DB_xref: GI:193075566 Feature: CDS: transl_table = 11; protein_id = 'ACF08649.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.