Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU325680_35.cds

[Submit comment/correction]

Sequence	EU325680_35.cds
Peptide	MTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN
Structure From Source	EU325680
Source Exons	1 117
Corresponding Protein	EU325680_35.protseq
Gene	psbL
Gene Product	PSII L protein
Remark	DB_xref: GI:193075571 Feature: CDS: transl_table = 11; protein_id = 'ACF08654.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.