Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU325680_36.cds

[Submit comment/correction]

Sequence	EU325680_36.cds
Peptide	MTIDRTYPIFTVRWLAIHGLAVPTVFFLGSISAMQFIQR
Structure From Source	EU325680
Source Exons	1 120
Corresponding Protein	EU325680_36.protseq
Gene	psbF
Gene Product	PSII cytochrome b559 4kDa subunit
Remark	DB_xref: GI:193075572 Feature: CDS: transl_table = 11; protein_id = 'ACF08655.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.