Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU325680_43.cds

Sequence	EU325680_43.cds
Peptide	MPTVKQLIRNARQPIRTARKTAALKGCPQRRGTCARVYTINPKKPNSALR KVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRG TLDAVAVKNRQQGRSKYGVKKPKK
Structure From Source	EU325680
Source Exons	1 114 59266 59497 60038 60066
Corresponding Protein	EU325680_43.protseq
Gene	rps12
Gene Product	ribosomal protein S12
Remark	DB_xref: GI:193075617 Feature: CDS: trans_splicing; transl_table = 11; protein_id = 'ACF08700.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.