Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU325680_53.cds

Sequence	EU325680_53.cds
Peptide	MKIRASVRKICTKCRLIRRRGRIRVICSNPKHKQRQG
Structure From Source	EU325680
Source Exons	1 114
Corresponding Protein	EU325680_53.protseq
Gene	rpl36
Gene Product	ribosomal protein L36
Remark	DB_xref: GI:193075588 Feature: CDS: transl_table = 11; protein_id = 'ACF08671.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.