Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EU379345_1.cds

Sequence	EU379345_1.cds
Peptide	MWKAHIKENGMGNLYLQCILLDRHGTKMEAIAYNSQAIRFNSVLETGRTY DFNRVGFNPTEMPDG
Structure From Source	EU379345
Source Exons	1 122 216 287
Corresponding Protein	EU379345_1.protseq
Gene Product	Ulp3
Remark	DB_xref: GI:170672187 Feature: CDS: inference = 'similar to RNA sequence, EST (same species):INSD:CA649228.1'; protein_id = 'ACB29730.1'; ; On complementary strand. Feature: CDS: inference = 'similar to RNA sequence, EST (same species):INSD:CA649228.1'; protein_id = 'ACB29730.1'; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.