Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY662492_1.cds

Sequence	AY662492_1.cds
Peptide	MASRRAHAAATMALLVVALVLSGAPAPAEGAVASCGQVVSYLAPCIGYAM GRERAPGGGCCTGVRSLNAAAATPADRQATCTCLKQQTSGMGGIKPDLVA GIPSKCGVNIPYAISPRTDCSKVR
Structure From Source	AY662492
Source Exons	1 365 502 511
Corresponding Protein	AY662492_1.protseq
Gene Product	non-specific lipid transfer protein 6
Remark	DB_xref: GI:55275991 Feature: CDS: protein_id = 'AAV49759.1' Gene: Ltp6
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.