Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY688471_1.cds

Sequence	AY688471_1.cds
Peptide	MSCNCGSGCSCGSDCKCGKMYPDLTEQGSAAAQVAAVVVLGVAPENKAGQ FEVAAGQSGEGCSCGDNCKCNPCNC
Structure From Source	AY688471
Source Exons	1 53 226 400
Corresponding Protein	AY688471_1.protseq
Gene Product	metallothionein
Remark	CDS note: metal binding protein DB_xref: GI:51243722 Feature: CDS: protein_id = 'AAT99565.1'
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.