Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY693779_1.cds

Sequence	AY693779_1.cds
Peptide	KPIHTSEIPPEDTVPQNQSHIHEGNFEKPAVGTSNELSLSKDNKQKRVRN DESKKQPLKRMKRG
Structure From Source	AY693779
Source Exons	1 83 242 353
Corresponding Protein	AY693779_1.protseq
Gene Product	CENP-C
Remark	CDS note: repeated domain 9q-10q DB_xref: GI:51477407 Feature: CDS: protein_id = 'AAU04612.1'
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.