Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY735987_1.cds

Sequence	AY735987_1.cds
Peptide	EFRPERFSQRVCYIQIRVHFAYIHVLPFGPGHRLC
Structure From Source	AY735987
Source Exons	1 105
Corresponding Protein	AY735987_1.protseq
Gene Product	cytochrome P450
Remark	CDS note: contains C and D domains including Heme-binding region DB_xref: GI:57546742 Feature: CDS: protein_id = 'AAW52239.1' Gene: CYP P450
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.