Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY763586_1.cds

Sequence	AY763586_1.cds
Peptide	GFSGGQRDLFEGILQAGSTIVENLRTYNQPAFVYIPKAAELRGGAWVVID
Structure From Source	AY763586
Source Exons	1 153
DB Remark	6.4.1.2
Corresponding Protein	AY763586_1.protseq
Gene Product	chloroplast acetyl-CoA carboxylase
Remark	CDS note: involved in fatty acid biosynthesis; ACCase DB_xref: GI:55668398 Feature: CDS: protein_id = 'AAV54201.1'
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.