Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY770690_1.cds

Sequence	AY770690_1.cds
Peptide	MSKPVKIGPWGGNGGSERDVQPKPIRMVSMTVSSGAIVDAIAFTYVGTDN VQHSSGIKWGGTGGTEDTINLDATNYVTEISGTVGKFGTDDIVTSLKIIT SKGVTRTYGSGTGIPFRVPVLDGGKIAGFFGRAGAFLDAIGFYITP
Structure From Source	AY770690
Source Exons	1 3 158 358 527 763
Corresponding Protein	AY770690_1.protseq
Gene Product	horcolin
Remark	CDS note: coleoptile lectin DB_xref: GI:54778542 Feature: CDS: protein_id = 'AAV39531.1'
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.