Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY781357_1.cds

Sequence	AY781357_1.cds
Peptide	MTVDRKDAEAAAAAATPFEIPALQPGGTCGAEESTRSHVLVKPIGKSDLG DHVMGLIQSLKRSGDGKK
Structure From Source	AY781357
Source Exons	1 207
Corresponding Protein	AY781357_1.protseq
Gene Product	DREB transcription factor 5C
Remark	CDS note: TaDREB5; dehydration responsive element binding protein; induced by abiotic stress; alternatively spliced DB_xref: GI:60100232 Feature: CDS: protein_id = 'AAX13285.1' Gene: DREB5
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.