Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY846827_1.cds

Sequence	AY846827_1.cds
Peptide	MPSHKTFRIKQKLAKKQRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLG F
Structure From Source	AY846827
Source Exons	1 156
Corresponding Protein	AY846827_1.protseq
Gene Product	ribosomal protein L39
Remark	DB_xref: GI:57471714 Feature: CDS: protein_id = 'AAW50988.1'
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.