Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY846831_1.cds

Sequence	AY846831_1.cds
Peptide	MGHSNVWNSHPKNYGAGSRVCRVCGNSHGLIRKYGLMCCRQCFRSDAKDI GFIKYR
Structure From Source	AY846831
Source Exons	1 171
Corresponding Protein	AY846831_1.protseq
Gene Product	ribosomal protein S29
Remark	DB_xref: GI:57471722 Feature: CDS: protein_id = 'AAW50992.1'
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.