Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY853252_9.cds

Sequence	AY853252_9.cds
Peptide	MARHIQLAVRMHIMAGTAEHCYAIKMETMLFVDTIPIIFPVLKGPVMDPF EHERTEHHPVVWGPRQGSKSTYKVEYWKQAVISSFPAILDLRRAAAHMAH RSTCFCALYFFPKIANGINKSDESRLIGDTSSVIILPHVNSHLVH
Structure From Source	AY853252
Source Exons	1 195 872 993 1067 1187
Corresponding Protein	AY853252_9.protseq
Gene	PSY-1
Gene Product	putative peptide synthetase
Remark	CDS note: HVPSY-1 DB_xref: GI:63147807 Feature: CDS: protein_id = 'AAY34257.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.