Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY896046_1.cds

Sequence	AY896046_1.cds
Peptide	HLMGEDLESLNLKELQQLEQQLESSLKHIRARKNQLMHESISELQKKERS LQEENKVLQKELVEKQKAQAAQQDQTQPQTSSSSSSFMMRDAPPVADTSN HPAAAGERAEDVAVQPQVPLRTALPLWMVSHING
Structure From Source	AY896046
Source Exons	1 100 299 340 484 525 615 727 978 1086
Corresponding Protein	AY896046_1.protseq
Gene Product	MADS box transcription factor
Remark	CDS note: phytochelatin synthetase DB_xref: GI:59936913 Feature: CDS: protein_id = 'AAX12151.1' Gene: Vrn1
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.