Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY924305_1.cds

Sequence	AY924305_1.cds
Peptide	MEGKRMLISTTTLKVIMCLLILSLAVNSTTADCGCCISFAAKACCSSCIF AGGSDFACKNTCCFPCLLEDSVVAKMDEMGVAPKMEGLY
Structure From Source	AY924305
Source Exons	1 214 458 513
Corresponding Protein	AY924305_1.protseq
Gene Product	thionin-like peptide
Remark	DB_xref: GI:60393201 Feature: CDS: protein_id = 'AAX19516.1'
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.