Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY951945_3.cds

Sequence	AY951945_3.cds
Peptide	MPMVAGEYALDMDGVVAVAAEERLASKQKTVAAIARVFPEEDEAPRASPI VASMHDGGSRLAISFLIGWMCPR
Structure From Source	AY951945
Source Exons	1 222
Corresponding Protein	AY951945_3.protseq
Gene Product	putative wheat powder tolerance-related protein
Remark	CDS note: similar to sequence in GenBank Accession Number AY330229 DB_xref: GI:63098618 Feature: CDS: protein_id = 'AAY32561.1'
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.