Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB027572_4.cds

[Submit comment/correction]

Sequence	AB027572_4.cds
Peptide	MEVNILAFIATALFILVPTSFLLIIYVKTVSQNN
Structure From Source	AB027572
Source Exons	1 105
Corresponding Protein	AB027572_4.protseq
Gene Product	PSII M-protein
Remark	DB_xref: GI:4958865 Feature: CDS: transl_table = 11; protein_id = 'BAA78038.1' Feature: CDS: transl_table = 11; protein_id = 'BAA78038.1'; Gene: psbM
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.