Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB042240_9.cds

[Submit comment/correction]

Sequence	AB042240_9.cds
Peptide	MTIAFQLAVFALIATSSVLVISVPLVFASPDGWSNNKNVVFSGTSLWIGL VFLVAILNSLIS
Structure From Source	AB042240
Source Exons	1 189
Corresponding Protein	AB042240_9.protseq
Gene	ycf9
Gene Product	PSII 43kDa protein
Remark	CDS note: Because RNA transcripts of wheat chloroplast genes for editing check have not been carried out, amino acid sequences deduced from the DNA nucleotides were simply shown. [ Show all 6 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.