Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB042240_47.cds

Sequence	AB042240_47.cds
Peptide	MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYNPKKPNSALRKV ARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTL DAVAVKNRQQGRLQYGVKKPKK
Structure From Source	AB042240
Source Exons	1 114 58599 58821 59362 59393
Corresponding Protein	AB042240_47.protseq
Gene Product	ribosomal protein S12 ribosomal protein L20
Remark	DB_xref: GI:13928227 DB_xref: GI:13928228 Feature: CDS: transl_table = 11; protein_id = 'BAB47056.1'; ; On complementary strand. Feature: CDS: transl_table = 11; protein_id = 'BAB47057.1'; ; On complementary strand. Gene: rpl20
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.