Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB042240_51.cds

[Submit comment/correction]

Sequence	AB042240_51.cds
Peptide	METATLVAISISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGD
Structure From Source	AB042240
Source Exons	1 132
Corresponding Protein	AB042240_51.protseq
Gene	psbN
Gene Product	PSII N-protein
Remark	DB_xref: GI:13928232 Feature: CDS: transl_table = 11; protein_id = 'BAB47061.1'; ; On complementary strand. Gene: psbN
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.