Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: FJ236243_1.cds

Sequence	FJ236243_1.cds
Peptide	HGHVGFMMSCYDAELSYDFCTDKFHARYPPHGRRTVVLEDGVQWDRVRAP RVGTLAHDLHASDCLHELRPGDNIEIQWRRNKEFPY
Structure From Source	FJ236243
Source Exons	1 80 244 422
Corresponding Protein	FJ236243_1.protseq
Gene Product	putative cyclin-like F-box
Remark	CDS note: equivalent locus in rice: LOC_Os01g17390 DB_xref: GI:207173986 Feature: CDS: protein_id = 'ACI23489.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.