Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: FJ374566_1.cds

Sequence	FJ374566_1.cds
Peptide	GGGAAMSIGQIKPVLLDLQCTTSDGEEYNFDLSKMVEACRNEEIESLVKK KYGQE
Structure From Source	FJ374566
Source Exons	1 92 770 807 919 955
Corresponding Protein	FJ374566_1.protseq
Gene Product	putative DNA binding protein
Remark	CDS note: equivalent locus in rice: LOC_Os01g48720 DB_xref: GI:210063897 Feature: CDS: protein_id = 'ACJ06624.1';
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.