Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: FJ374591_1.cds

Sequence	FJ374591_1.cds
Peptide	VQSVAWRSPEVLLSGSFDRTIALTDMKDTEQCCHKWPVEADVESLVCDPH NEHSFVVSLENGMVQAFDIRT
Structure From Source	FJ374591
Source Exons	1 69 519 617 953 996
Corresponding Protein	FJ374591_1.protseq
Gene Product	putative periodic tryptophan protein 1
Remark	CDS note: equivalent locus in rice: LOC_Os01g69970 DB_xref: GI:210077745 Feature: CDS: protein_id = 'ACJ07061.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.