Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: FJ374618_1.cds

Sequence	FJ374618_1.cds
Peptide	AKSLIELLPASDKSFSKLLCDAPCLPESLFRFLEGLCMSQGNNQQTKDSD GDRVTQGLGTVWSLILGRPPVRQACLDIVLKCAIHSQDEVRGKAVRLVAK KLYDLTYASEKVEQFATDSLLAIADKH
Structure From Source	FJ374618
Source Exons	1 243 588 635 716 805
Corresponding Protein	FJ374618_1.protseq
Gene Product	putative expressed protein
Remark	CDS note: equivalent locus in rice: LOC_Os01g49940 DB_xref: GI:210077791 Feature: CDS: protein_id = 'ACJ07084.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.