Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: FJ374627_1.cds

Sequence	FJ374627_1.cds
Peptide	LIPPEGAKLGERISFAGFDGKPEDVLNPKKKQLDKITP
Structure From Source	FJ374627
Source Exons	1 50 497 560
Corresponding Protein	FJ374627_1.protseq
Gene Product	putative methionyl-tRNA synthetase
Remark	CDS note: equivalent locus in rice: LOC_Os01g60660 DB_xref: GI:210077801 Feature: CDS: protein_id = 'ACJ07089.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.