Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: FJ394352_1.cds

Sequence	FJ394352_1.cds
Peptide	KSSTLVAEQCAWAIGNVAGEGADLRSTLIAQGALWPLARLMLSSKGSTAR TAAWALSNLIKGPDPKAAYELINIDGVLNAIIRNLEKADEELATEVAWVV V
Structure From Source	FJ394352
Source Exons	1 185 622 701 1179 1220
Corresponding Protein	FJ394352_1.protseq
Gene Product	putative importin alpha-2 subunit
Remark	CDS note: equivalent locus in rice: LOC_Os01g06470 DB_xref: GI:209944119 Feature: CDS: protein_id = 'ACI96315.1';
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.