Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: FJ867055_1.cds

Sequence	FJ867055_1.cds
Peptide	IPVRYLREDKPLGSAGGLNSFRDYIMEDSP
Structure From Source	FJ867055
Source Exons	1 11 121 199
Corresponding Protein	FJ867055_1.protseq
Gene	GMP1
Gene Product	GMP1
Remark	CDS note: part1 DB_xref: GI:226440111 Feature: CDS: protein_id = 'ACO56979.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.