Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: FJ867181_1.cds

Sequence	FJ867181_1.cds
Peptide	LEHSKYANLNDQLAEASLRLRQMRGEELDGLSVEELQQLEKKLETGLHRV LQTKDQQFLEQINELQRK
Structure From Source	FJ867181
Source Exons	1 62 147 246 323 364
Corresponding Protein	FJ867181_1.protseq
Gene	AGL11
Gene Product	AGL11
Remark	DB_xref: GI:226407157 Feature: CDS: protein_id = 'ACO52713.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.