Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB120303_1.cds

Sequence	AB120303_1.cds
Peptide	EAIVQTLNAGQIVSPDVVEVVVSPPYVFLPIVKAKLRPEIRVAAQNCWVK KGGAFTGEVSAEMLAN
Structure From Source	AB120303
Source Exons	1 56 181 304 628 646
Corresponding Protein	AB120303_1.protseq
Gene Product	cytosolic triosephosphate isomerase
Remark	DB_xref: GI:34787352 Feature: CDS: protein_id = 'BAC87785.1'; Gene: TPI
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.