Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB120304_1.cds

Sequence	AB120304_1.cds
Peptide	MARYAALAALLLAVAVGGAAAQGVGSVITQSVYAEHAAQPRQLAVPGQGV LHVRRLHRRRQHLPGLRHHRQRRRRQARARRLLRPDLPRDYRRDERRRRP VPMGLLLQGGDKQGHVSTLLWTGTHSIDRAVQLRSR
Structure From Source	AB120304
Source Exons	1 275 371 482 786 807
Corresponding Protein	AB120304_1.protseq
Gene Product	chitinase2
Remark	DB_xref: GI:34787354 Feature: CDS: protein_id = 'BAC87786.1'; Gene: CHI
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.