Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB120305_1.cds

Sequence	AB120305_1.cds
Peptide	VFLAAFPTECSSHRAANPSGHTKAGVHSIGVCNGVIGNNLPAPSDVVKLY KSKGINAMRIYAPESNVLKALSGTGIGVLMDVGNGVLPSLANDPSAAAAW VKANVQPYPGVSFRYIA
Structure From Source	AB120305
Source Exons	1 27 135 182 329 605
Corresponding Protein	AB120305_1.protseq
Gene Product	acidic beta-1,3-glucanase
Remark	DB_xref: GI:34787356 Feature: CDS: protein_id = 'BAC87787.1'; Gene: GLC
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.