Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB180925_2.cds

[Submit comment/correction]

Sequence	AB180925_2.cds
Peptide	MTDLNLPSIFVPLVGLVFPAIAMTSLFLYVQKNKIV
Structure From Source	AB180925
Source Exons	1 111
Corresponding Protein	AB180925_2.protseq
Gene	psaI
Gene Product	PSI small peptid
Remark	DB_xref: GI:48147239 Feature: CDS: transl_table = 11; protein_id = 'BAD22547.1' Feature: CDS: transl_table = 11; protein_id = 'BAD22547.1'; Gene: psaI
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.