Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB297610_1.cds

Sequence	AB297610_1.cds
Peptide	ASIKRMASQPAANSARPATVQIRGQPVEQKTSCCSS
Structure From Source	AB297610
Source Exons	1 99 358 369
Corresponding Protein	AB297610_1.protseq
Gene Product	hypothetical protein
Remark	CDS note: deduced cds based on the homology to cDNA clone bah45n12 DB_xref: GI:161339171 Feature: CDS: protein_id = 'BAF94006.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.