Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB297612_1.cds

Sequence	AB297612_1.cds
Peptide	ASIKRMASQPAANSARPATVQIRGQPVEQKTSCCSS
Structure From Source	AB297612
Source Exons	1 99 353 364
Corresponding Protein	AB297612_1.protseq
Gene Product	hypothetical protein
Remark	CDS note: deduced cds based on the homology to cDNA clone bah45n12 DB_xref: GI:161339175 Feature: CDS: protein_id = 'BAF94008.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.