Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: L37062_1.cds

Sequence	L37062_1.cds
Peptide	TVTVPKVEAKKPEVKSIQISGQSDEVECRAVAWSLAPVVVIK
Structure From Source	L37062
Source Exons	1 129
Corresponding Protein	L37062_1.protseq
Gene Product	heat shock protein 16.9
Remark	CDS note: mutated stop codon at position 66 causes readthrough and elongated protein DB_xref: GI:1449143 Feature: CDS: protein_id = 'AAB59350.1'; Gene: hsp16.9-11LC1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.