Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: M95500_1.cds

[Submit comment/correction]

Sequence	M95500_1.cds
Peptide	MASLGSSAGGRRPTVLLQIALFVVVAAIIINSSVCLGATAVHDAAASGTG ALDPNVPAVPTPGGAGQPYTGRGCRTVYGCRPPAGGQP
Structure From Source	M95500
Source Exons	1 142 257 381
Corresponding Protein	M95500_1.protseq
Remark	DB_xref: GI:170797 Feature: CDS: protein_id = 'AAA34311.1'; Gene: WIR1A
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.