Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_002762_9.cds

[Submit comment/correction]

Sequence	NC_002762_9.cds
Peptide	MEVNILAFIATALFILVPTSFLLIIYVKTVSQNN
Structure From Source	NC_002762
Source Exons	1 105
Corresponding Protein	NC_002762_9.protseq
Gene	psbM
Gene Product	photosystem II 44 kDa protein Ycf9 photosystem II M protein
Remark	DB_xref: GI:14017559 [ Show all 11 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.