Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_002762_17.cds

[Submit comment/correction]

Sequence	NC_002762_17.cds
Peptide	MKNVTHSFVFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIFFGKGVLK DLLDNRKQRILSTIRNSEELRRGTIEQLEKARIRLQKVELEADEYRMNGY SEIEREKANLINATSISLEQLEKSKNETLYFEKQRAMNQVRQRVFQQAVQ GALGTLNSCLNTELHFRTIRANIGILGSLEWKR
Structure From Source	NC_002762
Source Exons	1 145 970 1376
Corresponding Protein	NC_002762_17.protseq
Gene	atpF
Gene Product	ATP synthase CF0 A chain ATP synthase CF0 C chain ATP synthase CF0 B chain
Remark	CDS note: ATPase III subunit [ Show all 14 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.