Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_002762_19.cds

[Submit comment/correction]

Sequence	NC_002762_19.cds
Peptide	MAKKSLIQREKKRQKLEQKYHLIRQSLKKKIRSKVSPLSLSEKTKMREKL QSLPRNSAPTRLHRRCFLTGRPRANYRHFGLSGHVLREMVYECLLPGATR SSW
Structure From Source	NC_002762
Source Exons	1 312 970 1376
Corresponding Protein	NC_002762_19.protseq
Gene	rps14
Gene Product	ATP synthase CF0 B chain ATP synthase CF1 alpha chain ribosomal protein S14
Remark	CDS note: ATPase alpha subunit [ Show all 13 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.