Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_002762_24.cds

[Submit comment/correction]

Sequence	NC_002762_24.cds
Peptide	MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAGDWDSIAVILYVYGYN YLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPS VFWIWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITP NFYEIQDAH
Structure From Source	NC_002762
Source Exons	1 480 891 1120 1877 2000
Corresponding Protein	NC_002762_24.protseq
Gene	ndhJ
Gene Product	photosystem I assembly protein Ycf3 ribosomal protein S4 NADH dehydrogenase subunit J
Remark	DB_xref: GI:14017574 [ Show all 11 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.