Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_002762_44.cds

[Submit comment/correction]

Sequence	NC_002762_44.cds
Peptide	MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYNPKKPNSALRKV ARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTL DAVAVKNRQQGRLQYGVKKPKK
Structure From Source	NC_002762
Source Exons	1 114 58599 58821 59362 59393
Corresponding Protein	NC_002762_44.protseq
Gene	rps12
Gene Product	ribosomal protein S12 ribosomal protein S18 ribosomal protein L20
Remark	DB_xref: GI:14017594 [ Show all 11 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.