Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_002762_48.cds

[Submit comment/correction]

Sequence	NC_002762_48.cds
Peptide	METATLVAISISGLLVSFTGYALYTAFGQPSQQLRDPFEEHGD
Structure From Source	NC_002762
Source Exons	1 132
Corresponding Protein	NC_002762_48.protseq
Gene	psbN
Gene Product	photosystem II protein T photosystem II protein N
Remark	DB_xref: GI:14017599 [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.