Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_007579_39.cds

Sequence	NC_007579_39.cds
Peptide	RESLRSRKIWSRRSSISPEFVDCSVLIYNGKTPVRCKITEGHKFGEFAFT RRRRPYRTNRGKGKK
Structure From Source	NC_007579
Source Exons	1 198
Corresponding Protein	NC_007579_39.protseq
Gene	rps19-p
Gene Product	rps19-p
Remark	CDS note: translational start codon is not determined [ Show all 6 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.