Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_009880_11.cds

Sequence	NC_009880_11.cds
Peptide	MPQLLPFYFLNQISFRFFGLFIMIYIFSRYILPSFIELFITRMFITKL
Structure From Source	NC_009880
Source Exons	1 147
Corresponding Protein	NC_009880_11.protseq
Gene Product	ATP synthase F0 subunit 8
Remark	CDS note: ATP8 DB_xref: GI:157816271 DB_xref: GeneID:5644524 Feature: CDS: locus_tag = 'TiinfMp11'; transl_table = 4; protein_id = 'YP_001492842.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.