Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_011032_22.cds

[Submit comment/correction]

Sequence	NC_011032_22.cds
Peptide	MPRSRVNGNFIDKTSSIVANILLRIIPTTSGEKRAFTYYRDGMLAQSEGN YAEALQNYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALE RNPFLPQAFNNMAVICHYRGEQAILQGDSEIAEAWFDQAAEYWKQAIALT PGNYIEAQNWLKITKRFEFE
Structure From Source	NC_011032
Source Exons	1 159 886 1115 1866 1989
Corresponding Protein	NC_011032_22.protseq
Gene	ycf3
Gene Product	photosystem I assembly protein Ycf3
Remark	DB_xref: GI:194033150 DB_xref: GeneID:6439779 Feature: CDS: locus_tag = 'BrdiC_p026'; transl_table = 11; protein_id = 'YP_002000488.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.