Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_011032_34.cds

[Submit comment/correction]

Sequence	NC_011032_34.cds
Peptide	MADTTGRIPLWLIGTVTGIPVIGLVGVFFYGSYSGLGSSL
Structure From Source	NC_011032
Source Exons	1 123
Corresponding Protein	NC_011032_34.protseq
Gene	psbJ
Gene Product	photosystem II protein J
Remark	DB_xref: GI:194033162 DB_xref: GeneID:6439866 Feature: CDS: locus_tag = 'BrdiC_p038'; transl_table = 11; protein_id = 'YP_002000500.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.