Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_011032_36.cds

[Submit comment/correction]

Sequence	NC_011032_36.cds
Peptide	MTIDRTYPIFTVRWLAIHGLAVPTVFFLGSISAMQFIQR
Structure From Source	NC_011032
Source Exons	1 120
Corresponding Protein	NC_011032_36.protseq
Gene	psbF
Gene Product	photosystem II protein VI
Remark	DB_xref: GI:194033164 DB_xref: GeneID:6439878 Feature: CDS: locus_tag = 'BrdiC_p040'; transl_table = 11; protein_id = 'YP_002000502.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.